General Information

  • ID:  hor005445
  • Uniprot ID:  P11185
  • Protein name:  Relaxin B chain
  • Gene name:  NA
  • Organism:  Balaenoptera edeni (Pigmy Bryde's whale)
  • Family:  insulin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Balaenoptera (genus), Balaenopteridae (family), Mysticeti (parvorder), Cetacea (infraorder), Whippomorpha (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  QSTNDLIKACGRELVRLWVEICGSVSWGRTAL
  • Length:  32(1-32)
  • Propeptide:  QSTNDLIKACGRELVRLWVEICGSVSWGRTALRMTLSEKCCQVGCIRKDIARLC
  • Signal peptide:  NA
  • Modification:  T1 Pyrrolidone carboxylic acid
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  acts with estrogen to produce dilatation of the birth canal in many mammals
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P11185-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005445_AF2.pdbhor005445_ESM.pdb

Physical Information

Mass: 411526 Formula: C155H254N46O46S2
Absent amino acids: FHMPY Common amino acids: L
pI: 8.23 Basic residues: 4
Polar residues: 11 Hydrophobic residues: 13
Hydrophobicity: 11.56 Boman Index: -4487
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 106.56
Instability Index: 3732.5 Extinction Coefficient cystines: 11125
Absorbance 280nm: 358.87

Literature

  • PubMed ID:  2910872
  • Title:  Cetacean relaxin. Isolation and sequence of relaxins from Balaenoptera acutorostrata and Balaenoptera edeni.